PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK15478.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 554aa    MW: 61479.9 Da    PI: 4.8634
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK15478.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.91e-173986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ede+l  +v+q+G g+W+++ ++ g+ R++k+c++rw ++l
        PK15478.1 39 KGPWTANEDEILRTYVQQHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding47.15.7e-1592135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T +E++l++++++q G++ W++ a++++ gRt++++k++w++
        PK15478.1  92 KGAFTNDEEDLIINLHAQIGNK-WARMAARLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3823486IPR017930Myb domain
SMARTSM007175.7E-153888IPR001005SANT/Myb domain
SuperFamilySSF466891.24E-2938133IPR009057Homeodomain-like
PfamPF002491.7E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-244093IPR009057Homeodomain-like
CDDcd001673.15E-114186No hitNo description
PROSITE profilePS5129423.287141IPR017930Myb domain
SMARTSM007172.5E-1491139IPR001005SANT/Myb domain
PfamPF002499.6E-1492135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2494141IPR009057Homeodomain-like
CDDcd001675.79E-1094135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MSRSTNESED GQISHYQSDS SLIDENNGGS TSGGHVLKKG PWTANEDEIL RTYVQQHGEG  60
NWNAVQKHSG LSRCGKSCRL RWANHLRPDL KKGAFTNDEE DLIINLHAQI GNKWARMAAR  120
LPGRTDNEIK NYWNTRVKRR LRAGLPLYPT DLCLQARQEN QGQNTAGINC GDKGQSDHMN  180
AKNHIPPVIF NGLNGNPDGL QYFSELPTMS MNSMPMKGIV HPQYYSYMTL NRKKRLRETS  240
DDFPDSSGCV QNGYPLFDQC ENVNPGKDAN PWPTFQEDLD PNKILLPYDV TQGSHALSNG  300
NSSASNPIYG NVKLELPSLQ YTETDLGAWA TSAPPPLLDS VDSFMQSPPS VNVFEPECST  360
PHNSGLLEDL LHESKNLSSG KRHLSEKSPN SSSITPCDVV DNNPLNFCET EWEDYRESPF  420
CHSATSLLNE PITTSGSSLD EPLPLNSFPG NTVKPEPFDA DSVAAKEIEP IRQINFNHFD  480
RPDSLPLSDW FDQTTGYVDQ TLVNNTLASV LGGESTNDYK YMAASTASLS QDMMGFGHYS  540
WNAMPSVCQL SEHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-29361411105C-Myb DNA-Binding Domain
1msf_C2e-29361411105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135141RVKRRLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4560857e-36AM456085.1 Vitis vinifera contig VV78X211164.14, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015876156.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015876155.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015876154.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015876153.10.0PREDICTED: transcription factor GAMYB
TrEMBLW9QVM80.0W9QVM8_9R
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-106myb domain protein 65